PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000672.1.g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 302aa    MW: 33930.8 Da    PI: 6.8661
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000672.1.g00004.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.97.3e-27191240352
                          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                     + ++led+++yF+lpi++AAkeL+v++T+LKr+CR+++I+RWPhRkiksl
  FANhyb_rscf00000672.1.g00004.1 191 DALELEDIKQYFNLPITKAAKELKVGVTLLKRRCRELNIMRWPHRKIKSL 240
                                     6799********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.723174261IPR003035RWP-RK domain
PfamPF020421.8E-23193240IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVDSFDYLIN NSTNLGHHAM IESSGFSSSL CDSLVFDEML LREMVESLNT NVPSDVGQHE  60
VSMMVGSSGF SSTQCDSVVF DKKPISTMVE SFGNSSNVPS VFDHHEASMM TESAAAYSSS  120
HCNALVLYET PLSTIVDSFD YSDMPTPDLS DDEVSVKIES GYPSWGTSDI SCTRGTSNRG  180
RCSTQMKIKS DALELEDIKQ YFNLPITKAA KELKVGVTLL KRRCRELNIM RWPHRKIKSL  240
NSLIETMKRM GLRNEVKMLE ENKRLLELVP NMELTKRIKR LRQSIFKANY NKKKMSLSIS  300
LG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309145.10.0PREDICTED: uncharacterized protein LOC101293942 isoform X2
TrEMBLM1BL914e-47M1BL91_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000476811e-46(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.18e-39RWP-RK domain-containing protein